PDB entry 1pa3

View 1pa3 on RCSB PDB site
Description:
Deposited on 2003-05-13, released 2003-11-25
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-03, with a file datestamp of 2004-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1pa3a1, d1pa3a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1pa3b1, d1pa3b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pa3A (A:)
    mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
    ilqigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqne
    ttflnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnlyddietkypssl
    knfpllkahnefisnlpniknyitnrkesvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pa3A (A:)
    ivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpilqi
    gdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqnettfl
    nedlpkwsgyfekllkknhkyyfvgnnltyadlavfnlyddietkypsslknfpllkahn
    efisnlpniknyitnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pa3B (B:)
    mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
    ilqigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqne
    ttflnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnlyddietkypssl
    knfpllkahnefisnlpniknyitnrkesvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pa3B (B:)
    ivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpilqi
    gdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqnettfl
    nedlpkwsgyfekllkknhkyyfvgnnltyadlavfnlyddietkypsslknfpllkahn
    efisnlpniknyitnr