PDB entry 1pa1

View 1pa1 on RCSB PDB site
Description: Crystal structure of the C215D mutant of protein tyrosine phosphatase 1B
Class: hydrolase
Keywords: phosphatase, catalytic loop, active-site mutant, HYDROLASE
Deposited on 2003-05-13, released 2003-08-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.19
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine phosphatase, non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (12-309)
      • cloning artifact (8-11)
      • engineered (226)
    Domains in SCOPe 2.04: d1pa1a_
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pa1A (A:)
    mdykddddklefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrd
    vspfdhsriklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvv
    mlnrvmekgslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqet
    reilhfhyttwpdfgvpespasflnflfkvresgslspehgpvvvhdsagigrsgtfcla
    dtclllmdkrkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvq
    dqwkelshed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pa1A (A:)
    klefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
    iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
    gslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhy
    ttwpdfgvpespasflnflfkvresgslspehgpvvvhdsagigrsgtfcladtclllmd
    krkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelsh
    ed