PDB entry 1p9q

View 1p9q on RCSB PDB site
Description: Structure of a hypothetical protein AF0491 from Archaeoglobus fulgidus
Class: structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-05-12, released 2004-06-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Hypothetical protein AF0491
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0491
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1p9qc1, d1p9qc2, d1p9qc3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p9qC (C:)
    mgsshhhhhhssgrenlyfqghmvsldkaviarlrkggeefevlvdpylardlkegkevn
    fedllaaeevfkdakkgerasvdelrkifgtddvfeiarkiilegevqitaeqrremlea
    krkqiinfisrntidprtnaphppsrieraleeakvhidifksveaqvkdivkalkpilp
    lkfeemeiaikippehtgraisalynfggvtreewqrdgswicvmripsgmygdlmdllg
    kvakgealtkvlrrig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p9qC (C:)
    vsldkaviarlrkggeefevlvdpylardlkegkevnfedllaaeevfkdakkgerasvd
    elrkifgtddvfeiarkiilegevqitaeqrremleakrkqiinfisrntidpaphppsr
    ieraleeakvhidifksveaqvkdivkalkpilplkfeemeiaikippehtgraisalyn
    fggvtreewqrdgswicvmripsgmygdlmdllgkvakgealtkvlrrig