PDB entry 1p9q

View 1p9q on RCSB PDB site
Description: structure of a hypothetical protein af0491 from archaeoglobus fulgidus
Deposited on 2003-05-12, released 2004-06-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p9qC (C:)
    mgsshhhhhhssgrenlyfqghmvsldkaviarlrkggeefevlvdpylardlkegkevn
    fedllaaeevfkdakkgerasvdelrkifgtddvfeiarkiilegevqitaeqrremlea
    krkqiinfisrntidprtnaphppsrieraleeakvhidifksveaqvkdivkalkpilp
    lkfeemeiaikippehtgraisalynfggvtreewqrdgswicvmripsgmygdlmdllg
    kvakgealtkvlrrig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p9qC (C:)
    vsldkaviarlrkggeefevlvdpylardlkegkevnfedllaaeevfkdakkgerasvd
    elrkifgtddvfeiarkiilegevqitaeqrremleakrkqiinfisrntidpaphppsr
    ieraleeakvhidifksveaqvkdivkalkpilplkfeemeiaikippehtgraisalyn
    fggvtreewqrdgswicvmripsgmygdlmdllgkvakgealtkvlrrig