PDB entry 1p9m

View 1p9m on RCSB PDB site
Description: Crystal structure of the hexameric human IL-6/IL-6 alpha receptor/gp130 complex
Class: signaling protein/cytokine
Keywords: Ig domain, four helix bundle, cytokine, interleukin-6, gp130, signaling protein-cytokine COMPLEX
Deposited on 2003-05-12, released 2003-07-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.65 Å
R-factor: 0.282
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-6 receptor beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL6ST
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p9ma1, d1p9ma2, d1p9ma3
  • Chain 'B':
    Compound: interleukin-6
    Species: Homo sapiens [TaxId:9606]
    Gene: IL6 OR IFNB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p9mb_
  • Chain 'C':
    Compound: Interleukin-6 receptor alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IL6R
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p9mc1, d1p9mc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p9mA (A:)
    elldpcgyispespvvqlhsnftavcvlkekcmdyfhvnanyivwktnhftipkeqytii
    nrtassvtftdiaslniqltcniltfgqleqnvygitiisglppekpknlscivnegkkm
    rcewdggrethletnftlksewathkfadckakrdtptsctvdystvyfvnievwveaen
    algkvtsdhinfdpvykvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyr
    tkdastwsqippedtastrssftvqdlkpfteyvfrircmkedgkgywsdwseeasgit
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p9mA (A:)
    lldpcgyispespvvqlhsnftavcvlkekcmdyfhvnanyivwktnhftipkeqytiin
    rtassvtftdiaslniqltcniltfgqleqnvygitiisglppekpknlscivnegkkmr
    cewdggrethletnftlksewathkfadckakrdtptsctvdystvyfvnievwveaena
    lgkvtsdhinfdpvykvkpnpphnlsvinseelssilkltwtnpsiksviilkyniqyrt
    kdastwsqippedtastrssftvqdlkpfteyvfrircmkedgkgywsdwseeasgit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p9mB (B:)
    appvppgedskdvaaphrqpltsseridkqiryildgisalrketcnksnmcesskeala
    ennlnlpkmaekdgcfqsgfneetclvkiitgllefevyleylqnrfesseeqaravqms
    tkvliqflqkkaknldaittpdpttnaslltklqaqnqwlqdmtthlilrsfkeflqssl
    ralrqm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p9mB (B:)
    ltsseridkqiryildgisalrketcnkcesskealaennlnlpkmaekdgcfqsgfnee
    tclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaittpdp
    ttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p9mC (C:)
    eepqlscfrksplsnvvcewgprstpslttkavllvrkfqnspaedfqepcqysqesqkf
    scqlavpegdssfyivsmcvassvgskfsktqtfqgcgilqpdppanitvtavarnprwl
    svtwqdphswnssfyrlrfelryraersktfttwmvkdlqhhcvihdawsglrhvvqlra
    qeefgqgewsewspeamgtpw