PDB entry 1p9j

View 1p9j on RCSB PDB site
Description: Solution structure and dynamics of the EGF/TGF-alpha chimera T1E
Class: hormone/growth factor
Keywords: chimera, EGF, TGF-alpha, ErbB1, ErbB3, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2003-05-12, released 2003-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.97 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chimera of Epidermal growth factor(EGF) and Transforming growth factor alpha (TGF-alpha)
  Species: Homo sapiens [TaxId:9606]
  Gene: TGF-alpha and EGF
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01135 (0-6)
  • Uniprot P01133 (7-53)
  Domains in SCOPe 2.06: d1p9ja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1p9jA (A:)
  vvshfndcplshdgyclhdgvcmyiealdkyacncvvgyigercqyrdlkwwel