PDB entry 1p98

View 1p98 on RCSB PDB site
Description: High-resolution NMR structure of the Ubl-domain of HHR23A
Class: replication
Keywords: ubiquitin-like domain, REPLICATION
Deposited on 2003-05-09, released 2003-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uv excision repair protein rad23 homolog a
    Species: Homo sapiens [TaxId:9606]
    Gene: RAD23A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1p98a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p98A (A:)
mavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp
irdyrideknfvvvmvtk