PDB entry 1p8l

View 1p8l on RCSB PDB site
Description: New Crystal Structure of Chlorella Virus DNA Ligase-Adenylate
Deposited on 2003-05-07, released 2003-08-26
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-26, with a file datestamp of 2003-08-26.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.266
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p8lA (A:)
    hhhhhhmaitkpllaatleniedvqfpclatpkidgirsvkqtqmlsrtfkpirnsvmnr
    lltellpegsdgeisiegatfqdttsavmtghkmynakfsyywfdyvtddplkkyidrve
    dmknyitvhphilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykf
    grstlkegillkmkqfkdaeatiismtalfkntntktkdnfgyskrsthksgkveedvmg
    sievdydgvvfsigtgfdadqrrdfwqnkesyigkmvkfkyfemgskdcprfpvfigirh
    eedr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8lA (A:)
    aitkpllaatleniedvqfpclatpkidgirsvkqtqmlsrtfkpirnsvmnrlltellp
    egsdgeisiegatfqdttsavmtghkmynakfsyywfdyvtddplkkyidrvedmknyit
    vhphilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlke
    gillkmkqfkdaeatiismtalfknfgyedvmgsievdydgvvfsigtgfdadqrrdfwq
    nkesyigkmvkfkyfemgskdcprfpvfigirheed