PDB entry 1p8d

View 1p8d on RCSB PDB site
Description: X-Ray Crystal Structure of LXR Ligand Binding Domain with 24(S),25-epoxycholesterol
Class: membrane protein/protein binding
Keywords: LXR, epoxycholesterol, nuclear receptor, steroid receptor, liver X receptor, transcription, MEMBRANE PROTEIN-PROTEIN BINDING COMPLEX
Deposited on 2003-05-06, released 2003-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2 OR LXRB OR UNR OR NER
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p8da_
  • Chain 'B':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2 OR LXRB OR UNR OR NER
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p8db_
  • Chain 'C':
    Compound: Nuclear Receptor Coactivator 1 isoform 3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_671766
  • Chain 'D':
    Compound: Nuclear Receptor Coactivator 1 isoform 3
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB NP_671766
  • Heterogens: CO1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p8dA (A:)
    gsegegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrfahf
    telaiisvqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflk
    dftyskddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgr
    vealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklpp
    llseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8dA (A:)
    vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplqsrdarqqrfahftelaiisvqe
    ivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfh
    raglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyve
    allsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdvhe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p8dB (B:)
    gsegegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrfahf
    telaiisvqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflk
    dftyskddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgr
    vealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklpp
    llseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p8dB (B:)
    vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgasrdarqqrfahftelaiisvq
    eivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddf
    hraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyv
    eallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.