PDB entry 1p7p

View 1p7p on RCSB PDB site
Description: Methionyl-tRNA synthetase from Escherichia coli complexed with methionine phosphonate
Class: ligase
Keywords: Rossmann fold, ligase
Deposited on 2003-05-05, released 2004-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: metG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p7pa1, d1p7pa2, d1p7pa3
  • Heterogens: ZN, MPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p7pA (A:)
    tqvakkilvtcalpyangsihlghmlehiqadvwvryqrmrghevnficaddahgtpiml
    kaqqlgitpeqmigemsqehqtdfagfnisydnyhsthseenrqlseliysrlkengfik
    nrtisqlydpekgmflpdrfvkgtcpkckspdqygdncevcgatyspteliepksvvsga
    tpvmrdsehfffdlpsfsemlqawtrsgalqeqvankmqewfesglqqwdisrdapyfgf
    eipnapgkyfyvwldapigymgsfknlcdkrgdsvsfdeywkkdstaelyhfigkdivyf
    hslfwpamlegsnfrkpsnlfvhgyvtvngakmsksrgtfikastwlnhfdadslryyyt
    aklssriddidlnledfvqrvnadivnkvvnlasrnagfinkrfdgvlaseladpqlykt
    ftdaaevigeawesrefgkavreimaladlanryvdeqapwvvakqegrdadlqaicsmg
    inlfrvlmtylkpvlpklteraeaflnteltwdgiqqpllghkvnpfkalynridmrqve
    alveaskeevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p7pA (A:)
    akkilvtcalpyangsihlghmlehiqadvwvryqrmrghevnficaddahgtpimlkaq
    qlgitpeqmigemsqehqtdfagfnisydnyhsthseenrqlseliysrlkengfiknrt
    isqlydpekgmflpdrfvkgtcpkckspdqygdncevcgatyspteliepksvvsgatpv
    mrdsehfffdlpsfsemlqawtrsgalqeqvankmqewfesglqqwdisrdapyfgfeip
    napgkyfyvwldapigymgsfknlcdkrgdsvsfdeywkkdstaelyhfigkdivyfhsl
    fwpamlegsnfrkpsnlfvhgyvtvngakmsksrgtfikastwlnhfdadslryyytakl
    ssriddidlnledfvqrvnadivnkvvnlasrnagfinkrfdgvlaseladpqlyktftd
    aaevigeawesrefgkavreimaladlanryvdeqapwvvakqegrdadlqaicsmginl
    frvlmtylkpvlpklteraeaflnteltwdgiqqpllghkvnpfkalynridmrqvealv
    easke