PDB entry 1p7l

View 1p7l on RCSB PDB site
Description: S-Adenosylmethionine synthetase complexed with AMPPNP and Met.
Class: transferase
Keywords: S-Adenosylmethionine synthetase, AMPPNP, SAM, TRANSFERASE
Deposited on 2003-05-02, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-adenosylmethionine synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: METK OR METX OR B2942 OR C3528 OR Z4287 OR ECS3818 OR SF2933
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p7la1, d1p7la2, d1p7la3
  • Chain 'B':
    Compound: s-adenosylmethionine synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: METK OR METX OR B2942 OR C3528 OR Z4287 OR ECS3818 OR SF2933
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p7lb1, d1p7lb2, d1p7lb3
  • Chain 'C':
    Compound: s-adenosylmethionine synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: METK OR METX OR B2942 OR C3528 OR Z4287 OR ECS3818 OR SF2933
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p7lc1, d1p7lc2, d1p7lc3
  • Chain 'D':
    Compound: s-adenosylmethionine synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: METK OR METX OR B2942 OR C3528 OR Z4287 OR ECS3818 OR SF2933
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p7ld1, d1p7ld2, d1p7ld3
  • Heterogens: K, MG, ANP, MET, SAM, PPK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7lA (A:)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdinqgvdradpleqgagdqg
    lmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgi
    davvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcg
    ltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsy
    aigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghf
    grehfpwektdkaqllrdaaglk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7lB (B:)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdinqgvdradpleqgagdqg
    lmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgi
    davvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcg
    ltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsy
    aigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghf
    grehfpwektdkaqllrdaaglk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7lC (C:)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdinqgvdradpleqgagdqg
    lmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgi
    davvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcg
    ltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsy
    aigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghf
    grehfpwektdkaqllrdaaglk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7lD (D:)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdinqgvdradpleqgagdqg
    lmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgi
    davvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcg
    ltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsy
    aigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghf
    grehfpwektdkaqllrdaaglk