PDB entry 1p7k

View 1p7k on RCSB PDB site
Description: Crystal structure of an anti-ssDNA antigen-binding fragment (Fab) bound to 4-(2-Hydroxyethyl)piperazine-1-ethanesulfonic acid (HEPES)
Deposited on 2003-05-02, released 2004-05-11
The last revision prior to the SCOP 1.71 freeze date was dated 2004-05-11, with a file datestamp of 2004-05-11.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.197
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7kA (A:)
    elqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p7kB (B:)
    qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
    nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p7kB (B:)
    qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
    nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss
    akttppsvyplapgsnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1p7kH (H:)
    qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
    nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p7kH (H:)
    qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
    nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss
    akttppsvyplapgsaansmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1p7kL (L:)
    elqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p7kL (L:)
    elqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpltfgagtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne