PDB entry 1p7f

View 1p7f on RCSB PDB site
Description: GB3 solution structure obtained by refinement of X-ray structure with dipolar couplings
Class: immune system
Keywords: immune system
Deposited on 2003-05-01, released 2003-08-05
The last revision prior to the SCOP 1.73 freeze date was dated 2003-08-05, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin g binding protein g
    Species: Streptococcus sp. group G
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (2-55)
      • cloning artifact (0-1)
    Domains in SCOP 1.73: d1p7fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p7fA (A:)
    mqyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte