PDB entry 1p7b

View 1p7b on RCSB PDB site
Description: Crystal structure of an inward rectifier potassium channel
Deposited on 2003-05-01, released 2003-06-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-01-13, with a file datestamp of 2004-01-13.
Experiment type: XRAY
Resolution: 3.65 Å
R-factor: 0.295
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p7bA (A:)
    mnvdpfsphssdsfaqaasparkpprggrriwsgtreviaygmpasvwrdlyywalkvsw
    pvffaslaalfvvnntlfallyqlgdapianqsppgfvgafffsvetlatvgygdmhpqt
    vyahaiatleifvgmsgialstglvfarfarprakimfarhaivrpfngrmtlmvraana
    rqnviaearakmrlmrrehssegyslmkihdlklvrnehpifllgwnmmhvidessplfg
    etpeslaegramllvmiegsdettaqvmqarhawehddirwhhryvdlmsdvdgmthidy
    trfndtepveppgaapdaqafaakpgegdarpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p7bA (A:)
    reviaygmpasvwrdlyywalkvswpvffaslaalfvvnntlfallyqlgdapianqspp
    gfvgafffsvetlatvgygdmhpqtvyahaiatleifvgmsgialstglvfarfarprak
    imfarhaivrpfngrmtlmvraanarqnviaearakmrlmlmkihdlklvrnehpifllg
    wnmmhvidessplfgetpeslaegramllvmiegsdettaqvmqarhawehddirwhhry
    vdlmthidytrfndtepv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p7bB (B:)
    mnvdpfsphssdsfaqaasparkpprggrriwsgtreviaygmpasvwrdlyywalkvsw
    pvffaslaalfvvnntlfallyqlgdapianqsppgfvgafffsvetlatvgygdmhpqt
    vyahaiatleifvgmsgialstglvfarfarprakimfarhaivrpfngrmtlmvraana
    rqnviaearakmrlmrrehssegyslmkihdlklvrnehpifllgwnmmhvidessplfg
    etpeslaegramllvmiegsdettaqvmqarhawehddirwhhryvdlmsdvdgmthidy
    trfndtepveppgaapdaqafaakpgegdarpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p7bB (B:)
    reviaygmpasvwrdlyywalkvswpvffaslaalfvvnntlfallyqlgdapianqspp
    gfvgafffsvetlatvgygdmhpqtvyahaiatleifvgmsgialstglvfarfarprak
    imfarhaivrpfngrmtlmvraanarqnviaearakmrlmlmkihdlklvrnehpifllg
    wnmmhvidessplfgetpeslaegramllvmiegsdettaqvmqarhawehddirwhhry
    vdlmthidytrfndtepv