PDB entry 1p77

View 1p77 on RCSB PDB site
Description: crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae
Class: oxidoreductase
Keywords: Shikimate Dehydrogenase, Haemophilus influenzae, NADPH, OXIDOREDUCTASE
Deposited on 2003-04-30, released 2003-08-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.205
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shikimate 5-dehydrogenase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: AROE OR HI0655
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1p77a1, d1p77a2
  • Heterogens: ACT, ATR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p77A (A:)
    mdlyavwgnpiaqskspliqnklaaqthqtmeyiaklgdldafeqqllaffeegakgcni
    tspfkerayqladeysqraklaeacntlkklddgklyadntdgiglvtdlqrlnwlrpnq
    hvlilgaggatkgvllpllqaqqnivlanrtfsktkelaerfqpygniqavsmdsiplqt
    ydlvinatsaglsggtasvdaeilklgsafydmqyakgtdtpfialckslgltnvsdgfg
    mlvaqaahsfhlwrgvmpdfvsvyeqlkkaml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p77A (A:)
    mdlyavwgnpiaqskspliqnklaaqthqtmeyiaklgdldafeqqllaffeegakgcni
    tspfkerayqladeysqraklaeacntlkklddgklyadntdgiglvtdlqrlnwlrpnq
    hvlilgaggatkgvllpllqaqqnivlanrtfsktkelaerfqpygniqavsmdsiplqt
    ydlvinatsasvdaeilklgsafydmqyakgtdtpfialckslgltnvsdgfgmlvaqaa
    hsfhlwrgvmpdfvsvyeqlkkaml