PDB entry 1p74

View 1p74 on RCSB PDB site
Description:
Deposited on 2003-04-30, released 2003-08-12
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-26, with a file datestamp of 2003-08-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.231
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1p74a1, d1p74a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1p74b1, d1p74b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p74A (A:)
    mdlyavwgnpiaqskspliqnklaaqthqtmeyiaklgdldafeqqllaffeegakgcni
    tspfkerayqladeysqraklaeacntlkklddgklyadntdgiglvtdlqrlnwlrpnq
    hvlilgaggatkgvllpllqaqqnivlanrtfsktkelaerfqpygniqavsmdsiplqt
    ydlvinatsaglsggtasvdaeilklgsafydmqyakgtdtpfialckslgltnvsdgfg
    mlvaqaahsfhlwrgvmpdfvsvyeqlkkaml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p74A (A:)
    mdlyavwgnpiaqskspliqnklaaqthqtmeyiaklgdldafeqqllaffeegakgcni
    tspfkerayqladeysqraklaeacntlkklddgklyadntdgiglvtdlqrlnwlrpnq
    hvlilgaggatkgvllpllqaqqnivlanrtfsktkelaerfqpygniqavsmdsiplqt
    ydlvinatsagasvdaeilklgsafydmqyakgtdtpfialckslgltnvsdgfgmlvaq
    aahsfhlwrgvmpdfvsvyeqlkkaml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p74B (B:)
    mdlyavwgnpiaqskspliqnklaaqthqtmeyiaklgdldafeqqllaffeegakgcni
    tspfkerayqladeysqraklaeacntlkklddgklyadntdgiglvtdlqrlnwlrpnq
    hvlilgaggatkgvllpllqaqqnivlanrtfsktkelaerfqpygniqavsmdsiplqt
    ydlvinatsaglsggtasvdaeilklgsafydmqyakgtdtpfialckslgltnvsdgfg
    mlvaqaahsfhlwrgvmpdfvsvyeqlkkaml
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p74B (B:)
    mdlyavwgnpiaqskspliqnklaaqthqtmeyiaklgdldafeqqllaffeegakgcni
    tspfkerayqladeysqraklaeacntlkklddgklyadntdgiglvtdlqrlnwlrpnq
    hvlilgaggatkgvllpllqaqqnivlanrtfsktkelaerfqpygniqavsmdsiplqt
    ydlvinatsaasvdaeilklgsafydmqyakgtdtpfialckslgltnvsdgfgmlvaqa
    ahsfhlwrgvmpdfvsvyeqlkkaml