PDB entry 1p53

View 1p53 on RCSB PDB site
Description: The Crystal Structure of ICAM-1 D3-D5 fragment
Class: cell adhesion
Keywords: IgSF domain, beta-sheet, dimer, CELL ADHESION
Deposited on 2003-04-24, released 2004-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.06 Å
R-factor: 0.22
AEROSPACI score: -1.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intercellular adhesion molecule-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ICAM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p53a1, d1p53a2, d1p53a3
  • Chain 'B':
    Compound: intercellular adhesion molecule-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ICAM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1p53b1, d1p53b2, d1p53b3
  • Heterogens: NAG, NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p53A (A:)
    fvlpatppqlvsprvlevdtqgtvvcsldglfpvseaqvhlalgdqrlnptvtygndsfs
    akasvsvtaedegtqrltcavilgnqsqetlqtvtiysfpapnviltkpevsegtevtvk
    ceahprakvtlngvpaqplgpraqlllkatpedngrsfscsatlevagqlihknqtrelr
    vlygprlderdcpgnwtwpensqqtpmcqawgnplpelkclkdgtfplpigesvtvtrdl
    egtylcrarstqgevtrevtvnvlsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p53A (A:)
    fvlpatppqlvsprvlevdtqgtvvcsldglfpvseaqvhlalgdqrlnptvtygndsfs
    akasvsvtaedegtqrltcavilgnqsqetlqtvtiysfpapnviltkpevsegtevtvk
    ceagpraqlllkatpedngrsfscsatlevagqlihknqtrelrvlygprlderdcpgnw
    twpensqqtpmcqawgnplpelkclkdgtfplpigesvtvtrdlegtylcrarstqgevt
    revtvnvlsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p53B (B:)
    fvlpatppqlvsprvlevdtqgtvvcsldglfpvseaqvhlalgdqrlnptvtygndsfs
    akasvsvtaedegtqrltcavilgnqsqetlqtvtiysfpapnviltkpevsegtevtvk
    ceahprakvtlngvpaqplgpraqlllkatpedngrsfscsatlevagqlihknqtrelr
    vlygprlderdcpgnwtwpensqqtpmcqawgnplpelkclkdgtfplpigesvtvtrdl
    egtylcrarstqgevtrevtvnvlsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p53B (B:)
    fvlpatppqlvsprvlevdtqgtvvcsldglfpvseaqvhlalgdqrlnptvtygndsfs
    akasvsvtaedegtqrltcavilgnqsqetlqtvtiysfpapnviltkpevsegtevtvk
    ceagpraqlllkatpedngrsfscsatlevagqlihknqtrelrvlygprlderdcpgnw
    twpensqqtpmcqawgnplpelkclkdgtfplpigesvtvtrdlegtylcrarstqgevt
    revtvnvlsp