PDB entry 1p4o

View 1p4o on RCSB PDB site
Description: Structure of Apo unactivated IGF-1R KInase domain at 1.5A resolution.
Deposited on 2003-04-23, released 2003-04-29
The last revision prior to the SCOP 1.71 freeze date was dated 2003-04-29, with a file datestamp of 2003-04-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.209
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1p4oa_
  • Chain 'B':
    Domains in SCOP 1.71: d1p4ob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p4oA (A:)
    masvnpeyfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvai
    ktvneaasmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylr
    slrpamannpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkig
    dfgmtrdiyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqp
    yqglsneqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemep
    gfrevsfyyseenklpepeeld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4oA (A:)
    peyfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvne
    aasmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpa
    mannpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmt
    rdiyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqgls
    neqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrev
    sfyyseen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p4oB (B:)
    masvnpeyfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvai
    ktvneaasmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylr
    slrpamannpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkig
    dfgmtrdiyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqp
    yqglsneqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemep
    gfrevsfyyseenklpepeeld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4oB (B:)
    npeyfsaadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvn
    eaasmrerieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrp
    amannpvlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgm
    trdiyetdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqgl
    sneqvlrfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfre
    vsfyyseenklpep