PDB entry 1p4m

View 1p4m on RCSB PDB site
Description: crystal structure of riboflavin kinase
Class: transferase
Keywords: beta barrel, riboflavin kinase, flavin mononucleotide, transferase
Deposited on 2003-04-23, released 2003-05-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Riboflavin kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: FLJ11149
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q969G6 (0-146)
      • conflict (133)
    Domains in SCOPe 2.06: d1p4ma_
  • Heterogens: MG, ADP, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p4mA (A:)
    rhlpyfcrgqvvrgfgrgskqlgiptanfpeqvvdnlpadistgiyygwasvgsgdvhkm
    vvsigwnpyykntkksmethimhtfkedfygeilnvaivgylrpeknfdsleslisaiqg
    dieeakkrlelpeylkikednffqvsk