PDB entry 1p4f

View 1p4f on RCSB PDB site
Description: death associated protein kinase catalytic domain with bound inhibitor fragment
Class: transferase
Keywords: transferase, kinase
Deposited on 2003-04-23, released 2004-09-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DAPK1 OR DAPK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53355 (0-End)
      • see remark 999 (290-291)
    Domains in SCOPe 2.03: d1p4fa_
  • Heterogens: DRG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p4fA (A:)
    tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
    erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
    qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
    sntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalssawshpqfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p4fA (A:)
    tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
    erevsilkeiqhpnvitlhevyenktdvililelvaggelfdfteeeateflkqilngvy
    ylhslqiahfdlkpenimlldrnvprikiidfglahkidfgnefknifgtpefvapeivn
    yeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyfsntsalakd
    firrllvkdpkkrmtiqdslqhpwikpqf