PDB entry 1p35

View 1p35 on RCSB PDB site
Description: crystal structure of baculovirus p35
Class: apoptosis
Keywords: apoptosis, p35, cell death, baculovirus
Deposited on 1998-09-18, released 1999-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p35
    Species: Autographa californica nucleopolyhedrovirus [TaxId:46015]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p35a_
  • Chain 'B':
    Compound: p35
    Species: Autographa californica nucleopolyhedrovirus [TaxId:46015]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p35b_
  • Chain 'C':
    Compound: p35
    Species: Autographa californica nucleopolyhedrovirus [TaxId:46015]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1p35c_
  • Heterogens: PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p35A (A:)
    cvifpveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknn
    nlrdrikskvdeqfdqlerdysdqmdgfhdsikyfkdehysvscqngsvlkskfakilks
    hdytdkksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivp
    faheindtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksm
    iykalefttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntika
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p35B (B:)
    cvifpveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknn
    nlrdrikskvdeqfdqlerdysdqmdgfhdsikyfkdehysvscqngsvlkskfakilks
    hdytdkksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivp
    faheindtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksm
    iykalefttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntika
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p35B (B:)
    cvifpveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknn
    nlrdrikskvdeqfdqlerdysdqmdgfhdsikyfkdehysvscqngsvlkskfakilks
    hdytdkksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivp
    faheindtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksm
    iykalefttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1p35C (C:)
    cvifpveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknn
    nlrdrikskvdeqfdqlerdysdqmdgfhdsikyfkdehysvscqngsvlkskfakilks
    hdytdkksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivp
    faheindtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksm
    iykalefttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntika
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p35C (C:)
    cvifpveidvsqtiirdcqvdkqtrelvyinkimntqltkpvlmmfnisgpirsvtrknn
    nlrdrikskvdeqfdqlerdysdqmdgfhyfkdehysvscqngsvlkskfakilkshdyt
    dkksieayekyclpklvderndyyvavcvlkpgfengsnqvlsfeynpignkvivpfahe
    indtglyeydvvayvdsvqfdgeqfeefvqslilpssfknsekvlyyneasknksmiyka
    lefttesswgksekynwkifcngfiydkkskvlyvklhnvtsalnknvilntika