PDB entry 1p2k

View 1p2k on RCSB PDB site
Description: structural consequences of accommodation of four non-cognate amino- acid residues in the s1 pocket of bovine trypsin and chymotrypsin
Deposited on 2003-04-15, released 2004-04-20
The last revision prior to the SCOP 1.71 freeze date was dated 2004-04-20, with a file datestamp of 2004-04-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1p2ka_
  • Chain 'I':
    Domains in SCOP 1.71: d1p2ki_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p2kA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p2kI (I:)
rpdfcleppytgpcvariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga