PDB entry 1p28

View 1p28 on RCSB PDB site
Description: The crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae in complex with a component of the pheromonal blend: 3-hydroxy-butan-2-one.
Deposited on 2003-04-15, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-19, with a file datestamp of 2003-08-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.145
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1p28a_
  • Chain 'B':
    Domains in SCOP 1.67: d1p28b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p28A (A:)
    mdiginsdpnsstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacal
    dkvglispegaiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdlikn
    ftdcvrnsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p28A (A:)
    nsstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispe
    gaiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p28B (B:)
    mdiginsdpnsstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacal
    dkvglispegaiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdlikn
    ftdcvrnsy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p28B (B:)
    tqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispegai
    ytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy