PDB entry 1p1a

View 1p1a on RCSB PDB site
Description: NMR structure of ubiquitin-like domain of hHR23B
Class: DNA binding protein
Keywords: ubiquitin-like, DNA binding protein
Deposited on 2003-04-11, released 2004-07-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UV excision repair protein RAD23 homolog B
    Species: Homo sapiens [TaxId:9606]
    Gene: hHR23B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54727 (3-84)
      • cloning artifact (0-2)
    Domains in SCOPe 2.03: d1p1aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1p1aA (A:)
    gshmqvtlktlqqqtfkididpeetvkalkekiesekgkdafpvagqkliyagkilnddt
    alkeykideknfvvvmvtkpkavst