PDB entry 1p16

View 1p16 on RCSB PDB site
Description: Structure of an mRNA capping enzyme bound to the phosphorylated carboxyl-terminal domain of RNA polymerase II
Deposited on 2003-04-11, released 2003-07-15
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-15, with a file datestamp of 2003-07-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p16A (A:)
    mvqleereipvipgnkldeeetkelrlmvaellgrrntgfpgsqpvsferrhleetlmqk
    dyfvcektdglrcllflindpdkgegvflvtrendyyfipnihfplsvnetrekptyhhg
    tlldgelvlenrnvsepvlryvifdalaihgkciidrplpkrlgyitenvmkpfdnfkkh
    npdivnspefpfkvgfktmltsyhaddvlskmdklfhasdgliytcaetpyvfgtdqtll
    kwkpaeentvdfqlefvfnevqdpdlderdptstyldydakpnliklrvwqgsnvhtdfa
    kldlsdddwerlkaleqplqgriaecrqsttkkgywemlrfrndksngnhisvvekilvs
    ikdgvkekeviewcpkisrawkkrendrrqkhfng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p16A (A:)
    mvqleereipvipgnkldeeetkelrlmvaellgrrntgfpgsqpvsferrhleetlmqk
    dyfvcektdglrcllflindpdkgegvflvtrendyyfipnihfplsvnetrekptyhhg
    tlldgelvlenrnvsepvlryvifdalaihgkciidrplpkrlgyitenvmkpfdnfkkh
    npdivnspefpfkvgfktmltsyhaddvlskmdklfhasdgliytcaetpyvfgtdqtll
    kwkpaeentvdfqlefvfnevqdpdlderdptstyldydakpnliklrvwqgsnvhtdfa
    kldlsdddwerlkaleqplqgriaecrqsttkkgywemlrfrndksngnhisvvekilvs
    ikdgvkekeviewcpkisrawkkrendrrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p16B (B:)
    mvqleereipvipgnkldeeetkelrlmvaellgrrntgfpgsqpvsferrhleetlmqk
    dyfvcektdglrcllflindpdkgegvflvtrendyyfipnihfplsvnetrekptyhhg
    tlldgelvlenrnvsepvlryvifdalaihgkciidrplpkrlgyitenvmkpfdnfkkh
    npdivnspefpfkvgfktmltsyhaddvlskmdklfhasdgliytcaetpyvfgtdqtll
    kwkpaeentvdfqlefvfnevqdpdlderdptstyldydakpnliklrvwqgsnvhtdfa
    kldlsdddwerlkaleqplqgriaecrqsttkkgywemlrfrndksngnhisvvekilvs
    ikdgvkekeviewcpkisrawkkrendrrqkhfng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p16B (B:)
    mvqleereipvipgnkldeeetkelrlmvaellgrrntgfpgsqpvsferrhleetlmqk
    dyfvcektdglrcllflindpdkgegvflvtrendyyfipnihfplsvnetrekptyhhg
    tlldgelvlenrnvsepvlryvifdalaihgkciidrplpkrlgyitenvmkpfdnfkkh
    npdivnspefpfkvgfktmltsyhaddvlskmdklfhasdgliytcaetpyvfgtdqtll
    kwkpaeentvdfqlefvfnevqyldydakpnliklrvwqgsnvhtdfakldlsdddwerl
    kaleqplqgriaecrqsttkkgywemlrfrndksngnhisvvekilvsikdgvkekevie
    wcpkisrawkkrendrr