PDB entry 1ozu

View 1ozu on RCSB PDB site
Description: Crystal Structure of Familial ALS Mutant S134N of human Cu,Zn Superoxide Dismutase (CuZnSOD) to 1.3A resolution
Class: oxidoreductase
Keywords: beta barrel, amyloid-like linear filaments, OXIDOREDUCTASE
Deposited on 2003-04-09, released 2003-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.178
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441
      • modified residue (110)
    Domains in SCOPe 2.07: d1ozua_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • modified residue (110)
    Domains in SCOPe 2.07: d1ozub_
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ozuA (A:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneentktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ozuA (A:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggntktgnagsrlacgvigiaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ozuB (B:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneentktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ozuB (B:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnphvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekaddnagsrlac
    gvigiaq