PDB entry 1ozt

View 1ozt on RCSB PDB site
Description: Crystal Structure of apo-H46R Familial ALS Mutant human Cu,Zn Superoxide Dismutase (CuZnSOD) to 2.5A resolution
Class: oxidoreductase
Keywords: beta barrel, amyloid-like linear filaments, OXIDOREDUCTASE
Deposited on 2003-04-09, released 2003-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (45)
    Domains in SCOPe 2.07: d1oztg_
  • Chain 'H':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (45)
    Domains in SCOPe 2.07: d1ozth_
  • Chain 'I':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (45)
    Domains in SCOPe 2.07: d1ozti_
  • Chain 'J':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (45)
    Domains in SCOPe 2.07: d1oztj_
  • Chain 'K':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (45)
    Domains in SCOPe 2.07: d1oztk_
  • Chain 'L':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (45)
    Domains in SCOPe 2.07: d1oztl_
  • Chain 'M':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (45)
    Domains in SCOPe 2.07: d1oztm_
  • Chain 'N':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (45)
    Domains in SCOPe 2.07: d1oztn_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1oztG (G:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oztG (G:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekaddlggsr
    lacgvigiaq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1oztH (H:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oztH (H:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplrhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekaddlgkggn
    eagsrlacgvigiaq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1oztI (I:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oztI (I:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekaddlgkgg
    negsrlacgvigiaq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1oztJ (J:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oztJ (J:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplsrerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekaddlgk
    ggnsrlacgvigiaq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1oztK (K:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oztK (K:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekadsrlacg
    vigiaq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1oztL (L:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oztL (L:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnprhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekaddlgnagsr
    lacgvigiaq
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oztM (M:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oztN (N:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq