PDB entry 1ozo

View 1ozo on RCSB PDB site
Description: Three-dimensional solution structure of apo-S100P protein determined by NMR spectroscopy
Class: metal binding protein
Keywords: EF-hand, s100 protein, METAL BINDING PROTEIN
Deposited on 2003-04-09, released 2004-04-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: S-100P protein
  Species: Homo sapiens [TaxId:9606]
  Gene: S100P OR S100E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25815 (0-94)
    • conflict (5)
    • conflict (84)
    • conflict (91)
  Domains in SCOPe 2.06: d1ozoa_
• Chain 'B':
  Compound: S-100P protein
  Species: Homo sapiens [TaxId:9606]
  Gene: S100P OR S100E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25815 (0-94)
    • conflict (5)
    • conflict (84)
    • conflict (91)
  Domains in SCOPe 2.06: d1ozob_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ozoA (A:)
  mteleaamgmiidvfsrysgsegstqtltkgelkvlmekelpgflqsgkdkdavdkllkd
  ldangdaqvdfsefivfvaaitsashkyfektglk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ozoB (B:)
  mteleaamgmiidvfsrysgsegstqtltkgelkvlmekelpgflqsgkdkdavdkllkd
  ldangdaqvdfsefivfvaaitsashkyfektglk