PDB entry 1oz9

View 1oz9 on RCSB PDB site
Description: Crystal structure of AQ_1354, a hypothetical protein from Aquifex aeolicus
Class: unknown function
Keywords: matrix metalloproteinase type fold, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center
Deposited on 2003-04-08, released 2003-09-23
The last revision prior to the SCOP 1.75 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.207
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein AQ_1354
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1oz9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1oz9A (A:)
msstkrqknrvlvklkkrkvrkdkiekwaelalsalglnnvelsvyitddqeirelnkty
rkkdkptdvlsfpmgeefggykilgdvvisqdtaerqarelghsleeevkrlivhgivhl
lgydhekggeeekkfrelenyvlsklskal

    Sequence, based on observed residues (ATOM records): (download) 
    >1oz9A (A:)
knrvlvklkkrkvrkdkiekwaelalsalglnnvelsvyitddqeirelnktyrkkdkpt
dvlsfpmgeefggykilgdvvisqdtaerqarelghsleeevkrlivhgivhllgydhek
ggeeekkfrelenyvlsklsk