PDB entry 1oyb

View 1oyb on RCSB PDB site
Description: old yellow enzyme at 2 angstroms resolution: overall structure, ligand binding and comparison with related flavoproteins
Class: oxidoreductase(flavoprotein)
Keywords: oxidoreductase(flavoprotein)
Deposited on 1994-08-25, released 1994-11-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.173
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: old yellow enzyme
    Species: Saccharomyces pastorianus [TaxId:27292]
    Gene: OYE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1oyba_
  • Heterogens: FMN, HBA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oybA (A:)
    msfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytq
    raqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlwvlg
    waafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakn
    siaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighek
    vglrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflte
    gegeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdr
    lekglplnkydrdtfyqmsahgyidyptyeealklgwdkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oybA (A:)
    sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr
    aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlwvlgw
    aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns
    iaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv
    glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg
    egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl
    ekglplnkydrdtfyqmsahgyidyptyeealklgwdkk