PDB entry 1oxy

View 1oxy on RCSB PDB site
Description: crystallographic analysis of oxygenated and deoxygenated states of arthropod hemocyanin shows unusual differences
Class: oxygen transport
Keywords: oxygen transport, hemocyanin, copper protein
Deposited on 1995-01-06, released 1995-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.171
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemocyanin (subunit type II)
    Species: Limulus polyphemus [TaxId:6850]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04253 (0-End)
      • conflict (8)
      • conflict (407-408)
      • conflict (431)
      • conflict (548-549)
    Domains in SCOPe 2.07: d1oxya1, d1oxya2, d1oxya3
  • Heterogens: CU, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oxyA (A:)
    tlhdkqirichlfeqlssatvigdgdkhkhsdrlknvgklqpgaifscfhpdhleearhl
    yevfweagdfndfieiakeartfvneglfafaaevavlhrddckglyvppvqeifpdkfi
    psaaineafkkahvrpefdespilvdvqdtgnildpeyrlayyredvginahhwhwhlvy
    pstwnpkyfgkkkdrkgelfyymhqqmcarydcerlsngmhrmlpfnnfdeplagyaphl
    thvasgkyysprpdglklrdlgdieisemvrmrerildsihlgyvisedgshktldelhg
    tdilgalvessyesvnheyygnlhnwghvtmarihdpdgrfheepgvmsdtstslrdpif
    ynwhrfidnifheykntlkpydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhg
    inpgnarsikakyyhldhepfsyavnvqnnsasdkhatvriflapkydelgneikadelr
    rtaieldkfktdlhpgkntvvrhsldssvtlshqptfedllhgvglnehkseycscgwps
    hllvpkgnvagmeyhlfvmltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpf
    drpihtehisdfltnnmfikdikikfhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxyA (A:)
    tlhdkqirichlfeqlsrlknvgklqpgaifscfhpdhleearhlyevfweagdfndfie
    iakeartfvneglfafaaevavlhrddckglyvppvqeifpdkfipsaaineafkkgnil
    dpeyrlayyredvginahhwhwhlvypstwnpkyfgkkkdrkgelfyymhqqmcarydce
    rlsngmhrmlpfnnfdeplagyaphlthvasgkyysprpdglklrdlgdieisemvrmre
    rildsihlgyvisedgshktldelhgtdilgalvessyesvnheyygnlhnwghvtmari
    hdpdgrfheepgvmsdtstslrdpifynwhrfidnifheykntlkpydhdvlnfpdiqvq
    dvtlharvdnvvhtfmreqelelkhgsikakyyhldhepfsyavnvqnnsasdkhatvri
    flapkydelgneikadelrrtaieldkfktdlhpgkntvvrhsldssvtlshqptfedll
    seycscgwpshllvpkgnvagmeyhlfvmltdwdkdkvdvacvdavsycgardhkypdkk
    pmgfpfdrpihtehisdfltnnmfikdikikfh