PDB entry 1oxy

View 1oxy on RCSB PDB site
Description: crystallographic analysis of oxygenated and deoxygenated states of arthropod hemocyanin shows unusual differences
Deposited on 1995-01-06, released 1995-02-27
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-27, with a file datestamp of 1995-02-28.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.171
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1oxy_ (-)
    tlhdkqirichlfeqlssatvigdgdkhkhsdrlknvgklqpgaifscfhpdhleearhl
    yevfweagdfndfieiakeartfvneglfafaaevavlhrddckglyvppvqeifpdkfi
    psaaineafkkahvrpefdespilvdvqdtgnildpeyrlayyredvginahhwhwhlvy
    pstwnpkyfgkkkdrkgelfyymhqqmcarydcerlsngmhrmlpfnnfdeplagyaphl
    thvasgkyysprpdglklrdlgdieisemvrmrerildsihlgyvisedgshktldelhg
    tdilgalvessyesvnheyygnlhnwghvtmarihdpdgrfheepgvmsdtstslrdpif
    ynwhrfidnifheykntlkpydhdvlnfpdiqvqdvtlharvdnvvhtfmreqelelkhg
    inpgnarsikakyyhldhepfsyavnvqnnsasdkhatvriflapkydelgneikadelr
    rtaieldkfktdlhpgkntvvrhsldssvtlshqptfedllhgvglnehkseycscgwps
    hllvpkgnvagmeyhlfvmltdwdkdkvdgsesvacvdavsycgardhkypdkkpmgfpf
    drpihtehisdfltnnmfikdikikfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxy_ (-)
    tlhdkqirichlfeqlsrlknvgklqpgaifscfhpdhleearhlyevfweagdfndfie
    iakeartfvneglfafaaevavlhrddckglyvppvqeifpdkfipsaaineafkkgnil
    dpeyrlayyredvginahhwhwhlvypstwnpkyfgkkkdrkgelfyymhqqmcarydce
    rlsngmhrmlpfnnfdeplagyaphlthvasgkyysprpdglklrdlgdieisemvrmre
    rildsihlgyvisedgshktldelhgtdilgalvessyesvnheyygnlhnwghvtmari
    hdpdgrfheepgvmsdtstslrdpifynwhrfidnifheykntlkpydhdvlnfpdiqvq
    dvtlharvdnvvhtfmreqelelkhgsikakyyhldhepfsyavnvqnnsasdkhatvri
    flapkydelgneikadelrrtaieldkfktdlhpgkntvvrhsldssvtlshqptfedll
    seycscgwpshllvpkgnvagmeyhlfvmltdwdkdkvdvacvdavsycgardhkypdkk
    pmgfpfdrpihtehisdfltnnmfikdikikfh