PDB entry 1oww

View 1oww on RCSB PDB site
Description: Solution structure of the first type III module of human fibronectin determined by 1H, 15N NMR spectroscopy
Class: structural protein
Keywords: Fibronectin type III module, STRUCTURAL PROTEIN
Deposited on 2003-03-31, released 2003-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibronectin first type III module
    Species: Homo sapiens [TaxId:9606]
    Gene: FN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1owwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1owwA (A:)
gplgssgpvevfitetpsqpnshpiqwnapqpshiskyilrwrpknsvgrwkeatipghl
nsytikglkpgvvyegqlisiqqyghqevtrfdfttts

    Sequence, based on observed residues (ATOM records): (download) 
    >1owwA (A:)
sgpvevfitetpsqpnshpiqwnapqpshiskyilrwrpknsvgrwkeatipghlnsyti
kglkpgvvyegqlisiqqyghqevtrfdfttts