PDB entry 1owq

View 1owq on RCSB PDB site
Description: Crystal structure of a 40 kDa signalling protein (SPC-40) secreted during involution
Class: signaling protein
Keywords: signalling protein, MGP, SPC-40, SIGNALING PROTEIN
Deposited on 2003-03-29, released 2004-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal processing protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAP41220 (0-360)
      • engineered (157)
      • engineered (248)
      • engineered (250)
      • engineered (289)
    Domains in SCOPe 2.07: d1owqa1, d1owqa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1owqA (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpnlktllsvggwnfgserfskiasktqsrrtfiksvppflrthgfdgldlawly
    pgwrdkrhlttlvkemkaefvreaqagteqlllsaavpagkiaidrgydiaqisrhldfi
    slltydfhggwrgtvghhsplfrgnsdgssrfsnadyavsymlrlgapanklvmgiptfg
    rsytlassktdvgapisgpgipgqftkekgtlayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsaikdvlar
    v