PDB entry 1owg

View 1owg on RCSB PDB site
Description: Crystal structure of WT IHF complexed with an altered H' site (T44A)
Deposited on 2003-03-28, released 2003-07-15
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-15, with a file datestamp of 2003-07-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.226
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1owga_
  • Chain 'B':
    Domains in SCOP 1.65: d1owgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1owgA (A:)
    maltkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqr
    pgrnpktgedipitarrvvtfrpgqklksrvenaspkde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1owgA (A:)
    altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
    grnpktgedipitarrvvtfrpgqklksrvenaspk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1owgB (B:)
    mtkselierlatqqshipaktvedavkemlehmastlaqgerieirgfgsfslhyraprt
    grnpktgdkvelegkyvphfkpgkelrdraniyg