PDB entry 1ov4

View 1ov4 on RCSB PDB site
Description: Crystal structure of human DHEA-ST complexed with androsterone
Class: transferase
Keywords: alpha/beta fold, TRANSFERASE
Deposited on 2003-03-25, released 2004-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alcohol sulfotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: SULT2A1 OR STD OR HST
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06520 (9-292)
      • engineered (250)
    Domains in SCOPe 2.08: d1ov4a_
  • Heterogens: SO4, AOX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ov4A (A:)
    giprnsrvdsddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlae
    ilclmhskgdakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffss
    kakviylmrnprdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmp
    mreeknflllsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnys
    llsvdyvvdktqllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ov4A (A:)
    sddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskg
    dakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmr
    nprdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfll
    lsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkeyvvdktqlsgdwknhf
    tvaqaedfdklfqekmadlprelfpwe