PDB entry 1ouz

View 1ouz on RCSB PDB site
Description: Crystal structure of a mutant IHF (BetaE44A) complexed with a variant H' Site (T44A)
Deposited on 2003-03-25, released 2003-07-15
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-15, with a file datestamp of 2003-07-15.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.241
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ouza_
  • Chain 'B':
    Domains in SCOP 1.65: d1ouzb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ouzA (A:)
    maltkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqr
    pgrnpktgedipitarrvvtfrpgqklksrvenaspkde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ouzA (A:)
    altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
    grnpktgedipitarrvvtfrpgqklksrvenaspk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ouzB (B:)
    mtkselierlatqqshipaktvedavkemlehmastlaqgeriairgfgsfslhyraprt
    grnpktgdkvelegkyvphfkpgkelrdraniyg