PDB entry 1out

View 1out on RCSB PDB site
Description: trout hemoglobin I
Class: oxygen transport
Keywords: heme, oxygen transport, respiratory protein, erythrocyte
Deposited on 1996-06-21, released 1997-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.162
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin I
    Species: Oncorhynchus mykiss [TaxId:8022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1outa_
  • Chain 'B':
    Compound: hemoglobin I
    Species: Oncorhynchus mykiss [TaxId:8022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1outb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1outA (A:)
    sltakdksvvkafwgkisgkadvvgaealgrmltaypqtktyfshwadlspgsgpvkkhg
    giimgaigkavglmddlvggmsalsdlhafklrvdpgnfkilshnilvtlaihfpsdftp
    evhiavdkflaavsaaladkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1outB (B:)
    vewtdaekstisavwgkvnideigplalarvlivypwtqryfgsfgnvstpaaimgnpkv
    aahgkvvcgaldkavknmgnilatykslsethanklfvdpdnfrvladvltiviaakfga
    sftpeiqatwqkfmkvvvaamgsryf