PDB entry 1out

View 1out on RCSB PDB site
Description: trout hemoglobin i
Deposited on 1996-06-21, released 1997-01-11
The last revision prior to the SCOP 1.57 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.162
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1outa_
  • Chain 'B':
    Domains in SCOP 1.57: d1outb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1outA (A:)
    sltakdksvvkafwgkisgkadvvgaealgrmltaypqtktyfshwadlspgsgpvkkhg
    giimgaigkavglmddlvggmsalsdlhafklrvdpgnfkilshnilvtlaihfpsdftp
    evhiavdkflaavsaaladkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1outB (B:)
    vewtdaekstisavwgkvnideigplalarvlivypwtqryfgsfgnvstpaaimgnpkv
    aahgkvvcgaldkavknmgnilatykslsethanklfvdpdnfrvladvltiviaakfga
    sftpeiqatwqkfmkvvvaamgsryf