PDB entry 1oui

View 1oui on RCSB PDB site
Description: contribution of hydrophobic residues to the stability of human lysozyme: x-ray structure of the v93a mutant
Deposited on 1996-08-23, released 1997-02-12
The last revision prior to the SCOP 1.59 freeze date was dated 1997-02-12, with a file datestamp of 1997-02-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.159
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1oui__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oui_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadaaacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv