PDB entry 1oua

View 1oua on RCSB PDB site
Description: contribution of hydrophobic residues to the stability of human lysozyme: x-ray structure of the i56t mutant
Deposited on 1996-08-23, released 1997-02-12
The last revision prior to the SCOP 1.69 freeze date was dated 1997-02-12, with a file datestamp of 1997-02-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.148
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d1oua__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1oua_ (-)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygtfqin
  srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv