PDB entry 1otr

View 1otr on RCSB PDB site
Description: Solution Structure of a CUE-Ubiquitin Complex
Class: cell cycle
Keywords: protein-protein complex, cell cycle
Deposited on 2003-03-22, released 2003-06-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein Cue2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: CUE2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P36075 (0-48)
  Domains in SCOPe 2.05: d1otra_
• Chain 'B':
  Compound: Ubiquitin
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: UBI1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61864 (0-75)
  Domains in SCOPe 2.05: d1otrb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1otrA (A:)
  nddhesklsilmdmfpaisksklqvhllennndldltiglllkenddks
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1otrB (B:)
  mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
  iqkestlhlvlrlrgg