PDB entry 1otp

View 1otp on RCSB PDB site
Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase
Class: phosphorylase
Keywords: phosphorylase, pyrimidine metabolism, salvage pathway, domain movement, transferase, glycosyltransferase
Deposited on 1997-11-09, released 1998-12-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.201
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidine phosphorylase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1otpa1, d1otpa2, d1otpa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1otpA (A:)
    lflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
    mamrdsgtvldwkslhlngpivdkhstggvgdvtslmlgpmvaacggyipmisgrglght
    ggtldklesipgfdifpddnrfreiikdvgvaiigqtsslapadkrfyatrditatvdsi
    plitasilakklaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttallt
    dmnqvlassagnavevreavqfltgeyrnprlfdvtmalcvemlisgklakddaearakl
    qavldngkaaevfgrmvaaqkgptdfvenyakylptamltkavyadtegfvsemdtralg
    mavvamgggrrqasdtidysvgftdmarlgdqvdgqrplavihakdennwqeaakavkaa
    ikladkapestptvyrrise