PDB entry 1ot4

View 1ot4 on RCSB PDB site
Description: Solution structure of Cu(II)-CopC from Pseudomonas syringae
Class: metal binding protein
Keywords: copper trafficking, paramagnetic proteins, type II copper(II), Structural Proteomics in Europe, SPINE, Structural Genomics
Deposited on 2003-03-21, released 2003-07-08
The last revision prior to the SCOP 1.73 freeze date was dated 2003-07-08, with a file datestamp of 2007-06-04.
Experiment type: NMR35
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper resistance protein c
    Species: Pseudomonas syringae
    Gene: COPC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ot4a_
  • Heterogens: CU

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ot4A (A:)
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk