PDB entry 1osz

View 1osz on RCSB PDB site
Description: MHC class I h-2kb heavy chain complexed with beta-2 microglobulin and an (l4v) mutant of the vesicular stomatitis virus nucleoprotein
Class: complex (MHC I/peptide)
Keywords: MHC/peptide complex, transmembrane protein, thymic selection, complex (MHC I/peptide)
Deposited on 1998-06-18, released 1999-01-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.248
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I h-2kb heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: H-2B BETA2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1osza1, d1osza2
  • Chain 'B':
    Compound: beta-2 microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: H-2B BETA2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1oszb_
  • Chain 'C':
    Compound: vesicular stomatitis virus nucleoprotein
    Database cross-references and differences (RAF-indexed):
    • PDB 1OSZ (0-7)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oszA (A:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oszB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    No sequence available.