PDB entry 1os1

View 1os1 on RCSB PDB site
Description: Structure of Phosphoenolpyruvate Carboxykinase complexed with ATP,Mg, Ca and pyruvate.
Class: lyase
Keywords: enzyme mechanism, phosphotransfer,calcium,activation, LYASE
Deposited on 2003-03-18, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate carboxykinase [ATP]
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1os1a1, d1os1a2
  • Heterogens: MG, CA, ATP, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1os1A (A:)
    mrvnngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtg
    iftgrspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfv
    vdafcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqw
    keqglnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgek
    gdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepei
    ynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifl
    tadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptq
    yaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnl
    aiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1os1A (A:)
    nngltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgift
    grspkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvda
    fcganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeq
    glnsenfvafnltermqliggtwyggemkkgmfsmmnyllplkgiasmhcsanvgekgdv
    avffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcyaktiklskeaepeiyna
    irrdallenvtvredgtidfddgsktentrvsypiyhidnivkpvskaghatkvifltad
    afgvlppvsrltadqtqyhflsgftaklagtergiteptptfsacfgaaflslhptqyae
    vlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftlpmfnlaip
    telpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalvaagpkl