PDB entry 1oqy

View 1oqy on RCSB PDB site
Description: Structure of the DNA repair protein hHR23a
Deposited on 2003-03-11, released 2003-10-21
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-21, with a file datestamp of 2003-10-21.
Experiment type: NMR12
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oqyA (A:)
    gplgssavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkil
    sddvpirdyrideknfvvvmvtktkagqgtsappeasptaapesstsfppaptsgmshpp
    paaredkspseesapttspesvsgsvpssgssgreedaastlvtgseyetmlteimsmgy
    erervvaalrasynnphraveylltgipgspepehgsvqesqvseqpateaagenplefl
    rdqpqfqnmrqviqqnpallpallqqlgqenpqllqqisrhqeqfiqmlneppgeladis
    dvegevgaigeeapqmnyiqvtpqekeaierlkalgfpeslviqayfaceknenlaanfl
    lsqnfdde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqyA (A:)
    savtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp
    irdyrideknfvvvmvtktkagqgtsappeasptaapesstsfppaptsgmshpppaare
    dkspseesapttspesvsgsvpssgssgreedaastlvtgseyetmlteimsmgyererv
    vaalrasynnphraveylltgipgspepehgsvqesqvseqpateaagenpleflrdqpq
    fqnmrqviqqnpallpallqqlgqenpqllqqisrhqeqfiqmlneppgeladisdvege
    vgaigeeapqmnyiqvtpqekeaierlkalgfpeslviqayfaceknenlaanfllsqnf
    dde