PDB entry 1oqy

View 1oqy on RCSB PDB site
Description: Structure of the DNA repair protein hHR23a
Class: replication
Keywords: DNA repair, proteasome-mediated degradation, protein-protein interaction, REPLICATION
Deposited on 2003-03-11, released 2003-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uv excision repair protein rad23 homolog a
    Species: Homo sapiens [TaxId:9606]
    Gene: RAD23A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54725 (5-367)
      • see remark 999 (5)
    Domains in SCOPe 2.07: d1oqya1, d1oqya2, d1oqya3, d1oqya4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oqyA (A:)
    gplgssavtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkil
    sddvpirdyrideknfvvvmvtktkagqgtsappeasptaapesstsfppaptsgmshpp
    paaredkspseesapttspesvsgsvpssgssgreedaastlvtgseyetmlteimsmgy
    erervvaalrasynnphraveylltgipgspepehgsvqesqvseqpateaagenplefl
    rdqpqfqnmrqviqqnpallpallqqlgqenpqllqqisrhqeqfiqmlneppgeladis
    dvegevgaigeeapqmnyiqvtpqekeaierlkalgfpeslviqayfaceknenlaanfl
    lsqnfdde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqyA (A:)
    savtitlktlqqqtfkirmepdetvkvlkekieaekgrdafpvagqkliyagkilsddvp
    irdyrideknfvvvmvtktkagqgtsappeasptaapesstsfppaptsgmshpppaare
    dkspseesapttspesvsgsvpssgssgreedaastlvtgseyetmlteimsmgyererv
    vaalrasynnphraveylltgipgspepehgsvqesqvseqpateaagenpleflrdqpq
    fqnmrqviqqnpallpallqqlgqenpqllqqisrhqeqfiqmlneppgeladisdvege
    vgaigeeapqmnyiqvtpqekeaierlkalgfpeslviqayfaceknenlaanfllsqnf
    dde