PDB entry 1oqx

View 1oqx on RCSB PDB site
Description: G-2 glycovariant of human IgG Fc bound to minimized version of Protein A called Z34C
Class: immune system
Keywords: Antibody, Glycosylation, Oligosaccharides, IgG, Peptide complex, Z34C, Protein A
Deposited on 2003-03-11, released 2003-03-25
The last revision prior to the SCOP 1.73 freeze date was dated 2003-03-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.219
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin gamma-1 heavy chain constant region
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAC82527 (0-End)
    Domains in SCOP 1.73: d1oqxa1, d1oqxa2
  • Chain 'B':
    Compound: immunoglobulin gamma-1 heavy chain constant region
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAC82527 (0-End)
    Domains in SCOP 1.73: d1oqxb1, d1oqxb2
  • Chain 'C':
    Compound: Protein A Z34C
    Species: synthetic, synthetic
    Gene:
    Domains in SCOP 1.73: d1oqxc_
  • Chain 'D':
    Compound: Protein A Z34C
    Species: synthetic, synthetic
    Gene:
    Domains in SCOP 1.73: d1oqxd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oqxA (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqxA (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslslsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oqxB (B:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqxB (B:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqxC (C:)
    fnmqcqrrfyealhdpnlneeqrnakiksirddc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqxD (D:)
    fnmqcqrrfyealhdpnlneeqrnakiksirddc