PDB entry 1oqx

View 1oqx on RCSB PDB site
Description: g-2 glycovariant of human igg fc bound to minimized version of protein a called z34c
Deposited on 2003-03-11, released 2003-03-25
The last revision prior to the SCOP 1.65 freeze date was dated 2003-03-25, with a file datestamp of 2003-03-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.219
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oqxA (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqxA (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslslsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oqxB (B:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oqxB (B:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqxC (C:)
    fnmqcqrrfyealhdpnlneeqrnakiksirddc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oqxD (D:)
    fnmqcqrrfyealhdpnlneeqrnakiksirddc